Product Added to your Cart
x

-------- OR --------

INR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Jewelry Set
11 product(s) found for "Jewelry Set"
Coin Design Gold Plated Neck..
Jewelry Set
Coin Design Gold Plated Neck..
Beautiful Coin Design Gold Plated Bridal Necklace & Earring set with red, green and white stones
₹ 1455.00
Units in Stock: 50
₹ 1455.00
Details
Add To Cart
Beautiful Coin Design Gold Plated Bridal Necklace & Earring set with red, green and white stones
Mirror Oxidized Silver Neckl..
Jewelry Set
Mirror Oxidized Silver Neckl..
Beautiful Oxidized Silver Necklace and Earring set with Mirror and hangings
₹ 566.00
Units in Stock: 50
₹ 566.00
Details
Add To Cart
Beautiful Oxidized Silver Necklace and Earring set with Mirror and hangings
Oxidized Gold beaded Tradition
Necklace
Oxidized Gold beaded Tradition
Oxidized Gold Beautiful Elegant Pendant with beaded necklace & earring
₹ 898.00
Units in Stock: 150
₹ 898.00
Details
Add To Cart
Oxidized Gold Beautiful Elegant Pendant with beaded necklace & earring
Rose Gold Plated Necklace & ..
Jewelry Set
Rose Gold Plated Necklace & ..
Necklace Set and Earring : Rose Gold Plated on copper base With American Diamond beautiful jewellery set
₹ 947.00
Units in Stock: 225
₹ 947.00
Details
Add To Cart
Necklace Set and Earring : Rose Gold Plated on copper base With American Diamond beautiful jewellery set
Glass Stone with Pearl Jewel..
Jewelry Set
Glass Stone with Pearl Jewel..
Traditional Choker & Earring Set : Gold Plating with glass stone & pearl hangings Choker Necklace with Glass Stone Earring
₹ 679.00
Units in Stock: 85
₹ 679.00
Details
Add To Cart
Traditional Choker & Earring Set : Gold Plating with glass stone & pearl hangings Choker Necklace with Glass Stone Earring
Gold Plated Choker Necklace ..
Jewelry Set
Gold Plated Choker Necklace ..
Choker & Earring Set : Gold Plating on Brass & Copper base, with Cubic Zirconia/American Diamond Stones
₹ 882.00
Units in Stock: 50
₹ 882.00
Details
Add To Cart
Choker & Earring Set : Gold Plating on Brass & Copper base, with Cubic Zirconia/American Diamond Stones
Pearl Necklace & Earring Set
Jewelry Set
Pearl Necklace & Earring Set
Elegant Pearl Beads Gold Plated Jewellery set on brass base with Pearls and One pair of earring
₹ 745.00
Units in Stock: 120
₹ 745.00
Details
Add To Cart
Elegant Pearl Beads Gold Plated Jewellery set on brass base with Pearls and One pair of earring
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i